Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | ATP-dependent Clp protease ATP-binding subunit ClpC1 [1-145,E89Q] |
---|
Ligand | BDBM213240 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Isothermal Titration Calorimetry (ITC) |
---|
pH | 7.5±0 |
---|
Temperature | 298.15±0 K |
---|
Kd | 65±8 nM |
---|
Citation | Vasudevan, D; Rao, SP; Noble, CG Structural basis of mycobacterial inhibition by cyclomarin A J Biol Chem288:30883-91 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
ATP-dependent Clp protease ATP-binding subunit ClpC1 [1-145,E89Q] |
---|
Name: | ATP-dependent Clp protease ATP-binding subunit ClpC1 [1-145,E89Q] |
Synonyms: | CLPC1_MYCTU | Caseinolytic protein C1 (ClpC1 NTD E89Q) | clpC1 |
Type: | Protein |
Mol. Mass.: | 15982.26 |
Organism: | Mycobacterium tuberculosis |
Description: | M. tuberculosis ClpC1 N-terminal domain mutant E89Q |
Residue: | 145 |
Sequence: | MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR
SQVEEIIGQGQQAPSGHIPFTPRAKKVLQLSLREALQLGHNYIGTEHILLGLIREGEGVA
AQVLVKLGAELTRVRQQVIQLLSGY
|
|
|
BDBM213240 |
---|
n/a |
---|
Name | BDBM213240 |
Synonyms: | Cyclomarin A1 (CymA1) |
Type | Small organic molecule |
Emp. Form. | C59H92N10O11 |
Mol. Mass. | 1117.4222 |
SMILES | [#6]-[#8]-[#6@@H](-[#6@@H]-1-[#7]-[#6](=O)-[#6@H](-[#6])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6@@H](-[#6])-[#6]-[#8])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#6])-[#6])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6]-1=O)-[#6](-[#6])-[#6])-[#6@H](-[#6])\[#6]=[#6](/[#6])-[#6])-[#6@H](-[#8])-c1cn(c2ccccc12)C([#6])([#6])[#6@@H](-[#8])-[#6]-[#7]-[#6]-[#6]-[#6]-[#7])-c1ccccc1 |r| |
Structure |
|