Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 2 [256-363] |
---|
Ligand | BDBM213387 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | XIAP BIR3 & cIAP1 BIR3 Binding Assays (DELFIA) |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 1±n/a nM |
---|
Comments | extracted |
---|
Citation | Reiser, U; Madden, J 6-Alkynyl Pyridine US Patent US9278978 Publication Date 3/8/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 2 [256-363] |
---|
Name: | Baculoviral IAP repeat-containing protein 2 [256-363] |
Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Cellular inhibitor of apoptosis 1 (c-IAP1/BIR3) | Cellular inhibitor of apoptosis 1 BIR3 domain (c-IAP1 BIR3) | IAP repeat-containing protein 2 (cIAP1) BIR-3 | MIHB | RNF48 |
Type: | Enzyme |
Mol. Mass.: | 12600.71 |
Organism: | Homo sapiens (Human) |
Description: | Human cIAP BIR3 domain (256-363 aa) |
Residue: | 108 |
Sequence: | TLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTS
|
|
|
BDBM213387 |
---|
n/a |
---|
Name | BDBM213387 |
Synonyms: | US9278978, 22 |
Type | Small organic molecule |
Emp. Form. | C23H23N7OS |
Mol. Mass. | 445.54 |
SMILES | CN[C@H](C)C(=O)Nc1cc(cc(n1)C#Cc1cccs1)-c1nc(C)nc2nn(C)c(C)c12 |r| |
Structure |
|