Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Casein kinase II subunit beta |
---|
Ligand | BDBM219752 |
---|
Substrate/Competitor | BDBM220103 |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 7±n/a |
---|
IC50 | 65249±n/a nM |
---|
Comments | extracted |
---|
Citation | Haddach, M; Tran, JA; Pierre, F; Regan, CF; Raffaele, N; Ravula, S; Ryckman, DM Pyrazolopyrimidines and related heterocycles as CK2 inhibitors US Patent US9303033 Publication Date 4/5/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Casein kinase II subunit beta |
---|
Name: | Casein kinase II subunit beta |
Synonyms: | CK2N | CSK2B_HUMAN | CSNK2B | Casein kinase II subunit beta | Casein kinase II subunit beta (CK2 beta) | Casein kinase II subunit beta (CK2β) | G5A | Serine/threonine-protein kinase pim-2 |
Type: | Enzyme |
Mol. Mass.: | 24937.13 |
Organism: | Homo sapiens (Human) |
Description: | P67870 |
Residue: | 215 |
Sequence: | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
|
|
|
BDBM219752 |
---|
BDBM220103 |
---|
Name | BDBM219752 |
Synonyms: | US9303033, B48, Table 58A, Compound 25 | US9303033, H49, Table 59A, Compound 18 | US9303033, K36, Table 39A, Compound 59 |
Type | Small organic molecule |
Emp. Form. | C25H29N9O3 |
Mol. Mass. | 503.5563 |
SMILES | CC(C)N1CCN(CC1)c1ccc(Oc2nc(NC3CC3)n3ncc(\C=C4/NC(=O)NC4=O)c3n2)cc1 |
Structure |
|