Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protein M2-1 |
---|
Ligand | BDBM301477 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Antiviral Activity |
---|
EC50 | 166±n/a nM |
---|
Citation | Tahari, A; Vendeville, SM; Jonckers, TH; Raboisson, PJ; Demin, SD; Hu, L Piperidine substituted tricyclic pyrazolo[1,5-a]pyrimidine derivatives with inhibitory activity on the replication of the respiratory syncytial virus (RSV) US Patent US10131673 Publication Date 11/20/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein M2-1 |
---|
Name: | Protein M2-1 |
Synonyms: | Envelope-associated 22 kDa protein | M2-1 | M21_HRSVA | Matrix M2-1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 22163.59 |
Organism: | Human respiratory syncytial virus A (strain A2) |
Description: | P04545 |
Residue: | 194 |
Sequence: | MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEI
SGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEL
NSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPKEST
VSDTNDHAKNNDTT
|
|
|
BDBM301477 |
---|
n/a |
---|
Name | BDBM301477 |
Synonyms: | US10131673, Compound P4 |
Type | Small organic molecule |
Emp. Form. | C28H33N7O |
Mol. Mass. | 483.6079 |
SMILES | Cc1ccc2ncnc(N3CCCCC3c3cc4nc5CCCCc5c(N5CCOCC5)n4n3)c2c1 |
Structure |
|