| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein M2-1 |
|---|
| Ligand | BDBM301498 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Antiviral Activity |
|---|
| EC50 | 468±n/a nM |
|---|
| Citation |  Tahari, A; Vendeville, SM; Jonckers, TH; Raboisson, PJ; Demin, SD; Hu, L Piperidine substituted tricyclic pyrazolo[1,5-a]pyrimidine derivatives with inhibitory activity on the replication of the respiratory syncytial virus (RSV) US Patent US10131673 Publication Date 11/20/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein M2-1 |
|---|
| Name: | Protein M2-1 |
|---|
| Synonyms: | Envelope-associated 22 kDa protein | M2-1 | M21_HRSVA | Matrix M2-1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22163.59 |
|---|
| Organism: | Human respiratory syncytial virus A (strain A2) |
|---|
| Description: | P04545 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEI
SGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEL
NSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPKEST
VSDTNDHAKNNDTT
|
|
|
|---|
| BDBM301498 |
|---|
| n/a |
|---|
| Name | BDBM301498 |
|---|
| Synonyms: | US10131673, Compound P25 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H32N6O5S |
|---|
| Mol. Mass. | 540.634 |
|---|
| SMILES | Cc1ccc(NS(C)(=O)=O)c(c1)C(=O)N1CCCCC1c1cc2nc3COCc3c(N3CCOCC3)n2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
