| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Estrogen receptor [307-554] |
|---|
| Ligand | BDBM300925 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 6.90±n/a nM |
|---|
| Citation |  Barlaam, BC; O''Donovan, DH; Hughes, SJ; Moss, TA; Nissink, JW; Scott, JS; Yang, B Chemical compounds US Patent US10961241 Publication Date 3/30/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Estrogen receptor [307-554] |
|---|
| Name: | Estrogen receptor [307-554] |
|---|
| Synonyms: | ESR | ESR1 | ESR1_HUMAN | Estrogen receptor(ER) (aa 307-554) | NR3A1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 28281.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 307-554 |
|---|
| Residue: | 248 |
|---|
| Sequence: | ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPG
FVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFD
MLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTL
IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDA
HRLHAPTS
|
|
|
|---|
| BDBM300925 |
|---|
| n/a |
|---|
| Name | BDBM300925 |
|---|
| Synonyms: | N-(4-((6S,8R)-7-(2-fluoro-3-methoxy-2-methylpropyl)-8-methyl-6,7,8,9-tetrahydro-3H-pyrazolo[4,3-f]isoquinolin-6-yl)-3-methoxyphenyl)-1-(3-fluoropropyl)azetidin-3-amine (diastereoisomeric mixture) | US10131663, Example 4 | US10590130, Example 4 | US10961241, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H39F2N5O2 |
|---|
| Mol. Mass. | 527.6491 |
|---|
| SMILES | COCC(C)(F)CN1[C@H](C)Cc2c(ccc3[nH]ncc23)[C@H]1c1ccc(NC2CN(CCCF)C2)cc1OC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
