Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Kallikrein-1 |
---|
Ligand | BDBM408717 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibitory Activity Assay |
---|
IC50 | >40000±n/a nM |
---|
Citation | Davie, RL; Edwards, HJ; Evans, DM; Hodgson, ST N-((HET)arylmethyl)-heteroaryl-carboxamides compounds as plasma kallikrein inhibitors US Patent US11001578 Publication Date 5/11/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-1 |
---|
Name: | Kallikrein-1 |
Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
Type: | Enzyme |
Mol. Mass.: | 28874.69 |
Organism: | Homo sapiens (Human) |
Description: | P06870 |
Residue: | 262 |
Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
BDBM408717 |
---|
n/a |
---|
Name | BDBM408717 |
Synonyms: | N-[(3-fluoro-4-methoxypyridin-2-yl)methyl]-3-(methoxymethyl)-1-({4-[(2-oxopyridin- 1-yl)methyl]phenyl}methyl)pyrazole-4-carboxamide | US10364238, Example 41 | US10730874, Example 00397 | US11001578, Example 41 | US11084809, Example 41 | US11198691, Example 41 | US11352356, Table II.3 | US11584735, Example 41 of WO2016/083820 |
Type | Small organic molecule |
Emp. Form. | C26H26FN5O4 |
Mol. Mass. | 491.5141 |
SMILES | COCc1nn(Cc2ccc(Cn3ccccc3=O)cc2)cc1C(=O)NCc1nccc(OC)c1F |
Structure |
|