| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM514000 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding of Compounds to FKBP12 |
|---|
| Kd | 0.210±n/a nM |
|---|
| Citation |  Verdine, GL; Bowman, BR; Sowa, ME; Blodgett, JA; Robison, KE; Stiles, DT; Morgenstern, JP; Townson, SA; Shigdel, UK Compounds that participate in cooperative binding and uses thereof US Patent US11059830 Publication Date 7/13/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM514000 |
|---|
| n/a |
|---|
| Name | BDBM514000 |
|---|
| Synonyms: | (S)-1-(2-((2R,3R,6S)-6-((2R,3R,4S,6E,9E,11R,12R)-12-benzyl-3,11-dihydroxy-4-methyl-5-oxotetradeca-6,9-dien-2-yl)-2-hydroxy-3-methyltetrahydro-2H-pyran-2-yl)-2-oxoacetyl)piperidine-2-carboxylic acid C-11 lactone | US11059830, Compound 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H53NO8 |
|---|
| Mol. Mass. | 627.8079 |
|---|
| SMILES | CC[C@H](Cc1ccccc1)[C@@H]1CCCCCC(=O)[C@@H](C)[C@H](O)[C@@H](C)[C@@H]2CC[C@@H](C)C(O)(O2)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
