| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [265-330] |
|---|
| Ligand | BDBM518275 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Assay |
|---|
| Ki | <25000±n/a nM |
|---|
| Citation |  Cosford, ND; Vamos, MD Inhibitor of apoptosis protein (IAP) antagonists US Patent US11111270 Publication Date 9/7/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [265-330] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [265-330] |
|---|
| Synonyms: | API3 | BIRC4 | E3 ubiquitin-protein ligase XIAP/ BIR 3 | IAP3 | XIAP | XIAP_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 7652.55 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P98170[265-330] |
|---|
| Residue: | 66 |
|---|
| Sequence: | YEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWY
PGCKYL
|
|
|
|---|
| BDBM518275 |
|---|
| n/a |
|---|
| Name | BDBM518275 |
|---|
| Synonyms: | US11111270, Compound 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H31N5O3 |
|---|
| Mol. Mass. | 437.5346 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CCCNC2CCC(N2C1=O)C(=O)Nc1cccc2ccccc12 |r,w:12.11,19.20| |
|---|
| Structure | 
|
|---|
Search and Browse
