| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [163-230]/[26-93] |
|---|
| Ligand | BDBM391806 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Assay |
|---|
| Ki | <25000±n/a nM |
|---|
| Citation |  Cosford, ND; Vamos, MD Inhibitor of apoptosis protein (IAP) antagonists US Patent US11111270 Publication Date 9/7/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [163-230]/[26-93] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [163-230]/[26-93] |
|---|
| Synonyms: | E3 ubiquitin-protein ligase XIAP BIR1/2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | E3 ubiquitin-protein ligase XIAP [26-93] |
|---|
| Synonyms: | API3 | BIRC4 | E3 ubiquitin-protein ligase XIAP/BIR 1 | IAP3 | XIAP | XIAP_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 7519.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P98170[26-93] |
|---|
| Residue: | 68 |
|---|
| Sequence: | EFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRK
VSPNCRFI
|
|
|
|---|
| Component 2 |
| Name: | E3 ubiquitin-protein ligase XIAP [163-230] |
|---|
| Synonyms: | API3 | BIRC4 | E3 ubiquitin-protein ligase XIAP/ BIR2 | IAP3 | XIAP | XIAP_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 7983.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P98170[163-230] |
|---|
| Residue: | 68 |
|---|
| Sequence: | EEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRR
HFPNCFFV
|
|
|
|---|
| BDBM391806 |
|---|
| n/a |
|---|
| Name | BDBM391806 |
|---|
| Synonyms: | US10300074, Product 17c | US11111270, Compound 35 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H36N4O3S |
|---|
| Mol. Mass. | 472.643 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CCS[C@H]2CC(C)(C)C(N2C1=O)C(=O)N[C@@H]1CCCc2ccccc12 |r,w:16.21| |
|---|
| Structure | 
|
|---|
Search and Browse
