| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas [G12D,Q61H] |
|---|
| Ligand | BDBM485653 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Ras GTP Binding Domain Inhibition Assay |
|---|
| IC50 | <5000±n/a nM |
|---|
| Citation |  Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R Compounds that interact with the Ras superfamily for the treatment of cancers, inflammatory diseases, rasopathies, and fibrotic disease US Patent US11213515 Publication Date 1/4/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| GTPase KRas [G12D,Q61H] |
|---|
| Name: | GTPase KRas [G12D,Q61H] |
|---|
| Synonyms: | GTPase KRas (G12D, Q61H) | KRAS | KRAS2 | RASK2 | RASK_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21722.64 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01116[G12D,Q61H] |
|---|
| Residue: | 189 |
|---|
| Sequence: | MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
HEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
|
|
|
|---|
| BDBM485653 |
|---|
| n/a |
|---|
| Name | BDBM485653 |
|---|
| Synonyms: | US10940139, Example 02471 | US11000515, Compound TABLE 7.22 | US11213515, TABLE 7.22 | US11541041, Compound Table 7.1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16N6O |
|---|
| Mol. Mass. | 332.3592 |
|---|
| SMILES | O=C(CCc1c[nH]c2ccccc12)Nc1nnc([nH]1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
