| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stimulator of interferon genes protein [139-328] |
|---|
| Ligand | BDBM564855 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radiometric Filtration Binding Competition Assay |
|---|
| IC50 | <10000±n/a nM |
|---|
| Citation |  Chamberlain, BT; Rice, JM; Jernigan, III, FE; Sherman, W; Kulkarni, MM; Shechter, S; Allen, BK; Tan, D; Marino, KA; Lin, Z Oxoacridinyl acetic acid derivatives and methods of use US Patent US11414387 Publication Date 8/16/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stimulator of interferon genes protein [139-328] |
|---|
| Name: | Stimulator of interferon genes protein [139-328] |
|---|
| Synonyms: | Eris | Mita | Mpys | STING_MOUSE | Stimulator of interferon genes protein (STING)(139-328) | Sting | Sting1 | Tmem173 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21484.24 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | aa 139-328 |
|---|
| Residue: | 190 |
|---|
| Sequence: | TPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLY
ILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCIL
EYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTD
GNSFSLSQEV
|
|
|
|---|
| BDBM564855 |
|---|
| n/a |
|---|
| Name | BDBM564855 |
|---|
| Synonyms: | US11414387, Compound 9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H17NO3 |
|---|
| Mol. Mass. | 307.3432 |
|---|
| SMILES | OC(=O)Cn1c2ccccc2c(=O)c2ccc3CCCCc3c12 |
|---|
| Structure | 
|
|---|
Search and Browse
