| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Ligand | BDBM8740 |
|---|
| Substrate/Competitor | BDBM8737 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 26900±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI). Bioorg Med Chem Lett11:2061-5 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27861.12 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 262 |
|---|
| Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
|---|
| BDBM8740 |
|---|
| BDBM8737 |
|---|
| Name | BDBM8740 |
|---|
| Synonyms: | 1-[(3-nitrophenyl)methyl]-4-(thiophen-3-yl)-1H-imidazole | Disubstituted imidazole 8 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11N3O2S |
|---|
| Mol. Mass. | 285.321 |
|---|
| SMILES | O=N(=O)c1cccc(Cn2cnc(c2)-c2ccsc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
