Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM8741 |
---|
Substrate/Competitor | BDBM8737 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 5140±n/a nM |
---|
Comments | extracted |
---|
Citation | Heerding, DA; Chan, G; DeWolf, WE; Fosberry, AP; Janson, CA; Jaworski, DD; McManus, E; Miller, WH; Moore, TD; Payne, DJ; Qiu, X; Rittenhouse, SF; Slater-Radosti, C; Smith, W; Takata, DT; Vaidya, KS; Yuan, CC; Huffman, WF 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI). Bioorg Med Chem Lett11:2061-5 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM8741 |
---|
BDBM8737 |
---|
Name | BDBM8741 |
Synonyms: | 4-{[4-(thiophen-3-yl)-1H-imidazol-1-yl]methyl}aniline | Disubstituted imidazole 20 |
Type | Small organic molecule |
Emp. Form. | C14H13N3S |
Mol. Mass. | 255.338 |
SMILES | Nc1ccc(Cn2cnc(c2)-c2ccsc2)cc1 |
Structure |
|