Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterferon-induced, double-stranded RNA-activated protein kinase
LigandBDBM308062
Substrate/Competitorn/a
Meas. Tech.PDGFRβ Kinase Assay
Ki 558±n/a nM
Citation Boral SMalone TCWang SRao SYang R Heterocycle-substituted pyridyl benzothiophenes as kinase inhibitors US Patent  US9650366 Publication Date 5/16/2017
More Info.:Get all data from this article,  Assay Method
 
Interferon-induced, double-stranded RNA-activated protein kinase
Name:Interferon-induced, double-stranded RNA-activated protein kinase
Synonyms:EIF2AK2 | Eukaryotic translation initiation factor 2-alpha kinase 2 | Interferon-inducible RNA-dependent protein kinase | P1/eIF-2A protein kinase | PKR | PRKR | Protein kinase R | Protein kinase RNA-activated | Tyrosine-protein kinase EIF2AK2 | eIF-2A protein kinase 2 | p68 kinase
Type:PROTEIN
Mol. Mass.:62104.61
Organism:Homo sapiens (Human)
Description:ChEMBL_1467743
Residue:551
Sequence:
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM308062
n/a
NameBDBM308062
Synonyms:US9650366, 13
TypeSmall organic molecule
Emp. Form.C25H16ClF3N6OS
Mol. Mass.540.947
SMILESNc1ncc(cc1-c1cc2cc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)ccc2s1)-c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: