Reaction Details |
| Report a problem with these data |
Target | External core antigen |
---|
Ligand | BDBM576341 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | PHH Natural Infection Assay |
---|
IC50 | 850±n/a nM |
---|
Citation | Xianfeng, L; Jianping, W; Hongying, Y; Xiufang, Z SPIRO[3.3]HEPTANE DERIVATIVES FOR THE TREATMENT AND PROPHYLAXIS OF HEPATITIS B VIRUS INFECTION WIPOWO2022112188 Publication Date 6/2/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
External core antigen |
---|
Name: | External core antigen |
Synonyms: | C | HBEAG_HBVGB | HBeAg | Precore protein | p25 |
Type: | Protein |
Mol. Mass.: | 24103.68 |
Organism: | HBVgbn |
Description: | P89951 |
Residue: | 212 |
Sequence: | MQLFHLCLIISCSCPTVQASKLCLGWLLGMDIDPYKEFGASVELLSFLPSDFFPSVRDLL
DTASALYREALESPEHCSPNHTALRQAVLCWGELMTGCSWVGNNLEDPASRELVVNYVNT
NMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRR
RGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
|
|
|
BDBM576341 |
---|
n/a |
---|
Name | BDBM576341 |
Synonyms: | WO2022112188, Example 23 |
Type | Small organic molecule |
Emp. Form. | C23H22ClF2N3O4S2 |
Mol. Mass. | 542.018 |
SMILES | n/a |
Structure |
|