Reaction Details |
| Report a problem with these data |
Target | GTPase KRas [G12D,Q61H] |
---|
Ligand | BDBM485672 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Ras GTP Binding Domain Inhibition Assay |
---|
IC50 | 7500±n/a nM |
---|
Citation | Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R Compounds that interact with the Ras superfamily for the treatment of cancers, inflammatory diseases, Rasopathies, and fibrotic disease US Patent US11541041 Publication Date 1/3/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
GTPase KRas [G12D,Q61H] |
---|
Name: | GTPase KRas [G12D,Q61H] |
Synonyms: | GTPase KRas (G12D, Q61H) | KRAS | KRAS2 | RASK2 | RASK_HUMAN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21722.64 |
Organism: | Homo sapiens (Human) |
Description: | P01116[G12D,Q61H] |
Residue: | 189 |
Sequence: | MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
HEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
|
|
|
BDBM485672 |
---|
n/a |
---|
Name | BDBM485672 |
Synonyms: | US10940139, Example 02808 | US11000515, Compound TABLE 7.359 | US11213515, TABLE 7.359 | US11541041, Compound Table 7.338 |
Type | Small organic molecule |
Emp. Form. | C22H19N5O3S |
Mol. Mass. | 433.483 |
SMILES | Oc1ccc(cc1)C1CN(CCN1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1 |
Structure |
|