Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit alpha type-6 |
---|
Ligand | BDBM588482 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Proteasome Inhibitory Activity |
---|
IC50 | 6.60±n/a nM |
---|
Citation | Qin, Y Synthesis of peptide borate ester compound and use thereof US Patent US11542283 Publication Date 1/3/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit alpha type-6 |
---|
Name: | Proteasome subunit alpha type-6 |
Synonyms: | 27 kDa prosomal protein | Macropain iota chain | Multicatalytic endopeptidase complex iota chain | PROS-27 | PROS27 | PSA6_HUMAN | PSMA6 | Proteasome iota chain | p27K |
Type: | PROTEIN |
Mol. Mass.: | 27399.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_106197 |
Residue: | 246 |
Sequence: | MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
|
|
|
BDBM588482 |
---|
n/a |
---|
Name | BDBM588482 |
Synonyms: | (R)-N-(2,5-dichlorobenzoyl)-3- methylmercaptopropionamido-D- leucine borate citratte | US11542283, Compound V-9B |
Type | Small organic molecule |
Emp. Form. | C22H27BCl2N2O9S |
Mol. Mass. | 577.24 |
SMILES | CSC[C@H](NC(=O)c1cc(Cl)ccc1Cl)C(=O)N[C@@H](CC(C)C)B1OC(=O)CC(CC(O)=O)(O1)C(O)=O |r| |
Structure |
|