| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit alpha type-6 |
|---|
| Ligand | BDBM50462621 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Proteasome Inhibitory Activity |
|---|
| IC50 | 7.47±n/a nM |
|---|
| Citation |  Qin, Y Synthesis of peptide borate ester compound and use thereof US Patent US11542283 Publication Date 1/3/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit alpha type-6 |
|---|
| Name: | Proteasome subunit alpha type-6 |
|---|
| Synonyms: | 27 kDa prosomal protein | Macropain iota chain | Multicatalytic endopeptidase complex iota chain | PROS-27 | PROS27 | PSA6_HUMAN | PSMA6 | Proteasome iota chain | p27K |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27399.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_106197 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
|
|
|
|---|
| BDBM50462621 |
|---|
| n/a |
|---|
| Name | BDBM50462621 |
|---|
| Synonyms: | CHEMBL1813256 | MLN-9708 | US11542283, Compound MLN-9708 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23BCl2N2O9 |
|---|
| Mol. Mass. | 517.122 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)CNC(=O)c1cc(Cl)ccc1Cl)B1OC(=O)CC(CC(O)=O)(O1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
