Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM307668 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition of LPS-induced TNFalpha in Human PBMCs |
---|
IC50 | 5500±n/a nM |
---|
Citation | Brown, SD ASK1 inhibitor compounds and uses thereof US Patent US10150755 Publication Date 12/11/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM307668 |
---|
n/a |
---|
Name | BDBM307668 |
Synonyms: | 2-(6-(4-cyclopropyl- 4H-1,2,4-triazol-3- yl)pyridin-2-yl)-6- (5- cyclopropylpyrazin- 2-yll)isoindolin-1- one | US10150755, Compound 60 |
Type | Small organic molecule |
Emp. Form. | C25H21N7O |
Mol. Mass. | 435.4805 |
SMILES | O=C1N(Cc2ccc(cc12)-c1cnc(cn1)C1CC1)c1cccc(n1)-c1nncn1C1CC1 |
Structure |
|