| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4E [28-217] |
|---|
| Ligand | BDBM617346 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human eIF4E/4G2 Binding Assay |
|---|
| IC50 | <1000±n/a nM |
|---|
| Citation |  Vandeusen, CL; Walts, AE; Or, YS EIF4E inhibitors and uses thereof US Patent US11753403 Publication Date 9/12/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4E [28-217] |
|---|
| Name: | Eukaryotic translation initiation factor 4E [28-217] |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22131.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 28-217 |
|---|
| Residue: | 190 |
|---|
| Sequence: | VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMP
GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSD
DVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKS
GSTTKNRFVV
|
|
|
|---|
| BDBM617346 |
|---|
| n/a |
|---|
| Name | BDBM617346 |
|---|
| Synonyms: | US11753403, Compound I-273 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H19Cl2N3O2S2 |
|---|
| Mol. Mass. | 504.452 |
|---|
| SMILES | CC(C)Cc1sc(Nc2cc(sc2C(O)=O)-c2cccnc2)nc1-c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
