Reaction Details |
| Report a problem with these data |
Target | Histone acetyltransferase KAT2B [719-832] |
---|
Ligand | BDBM311504 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | PCAF AlphaLisa Binding Assay |
---|
IC50 | 73.0±n/a nM |
---|
Citation | Albrecht, BK; Cote, A; Crawford, T; Duplessis, M; Good, AC; LeBlanc, Y; Magnuson, S; Nasveschuk, CG; Pastor, R; Romero, AF; Taylor, AM Therapeutic compounds and uses thereof US Patent US10155764 Publication Date 12/18/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histone acetyltransferase KAT2B [719-832] |
---|
Name: | Histone acetyltransferase KAT2B [719-832] |
Synonyms: | KAT2B | KAT2B_HUMAN | PCAF | PCAF (aa 719-832) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13623.13 |
Organism: | Homo sapiens (Human) |
Description: | Q92831[719-832] |
Residue: | 114 |
Sequence: | SKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLK
NRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
|
|
|
BDBM311504 |
---|
n/a |
---|
Name | BDBM311504 |
Synonyms: | CHEM-US-00223 | US10155764, Example 79 |
Type | Small organic molecule |
Emp. Form. | C21H26N4O2 |
Mol. Mass. | 366.4567 |
SMILES | COc1ccc(cc1)[C@@H]([C@H](C)Nc1nn(C)c(=O)c2ccccc12)N(C)C |r| |
Structure |
|