| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50374605 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Receptor Assay |
|---|
| Ki | 4.98±0.42 nM |
|---|
| Citation |  McCurdy, CR; Mesangeau, C; Chin, FT; James, ML; Shen, B; Gambhir, S Highly selective sigma receptor radioligands US Patent US9604926 Publication Date 3/28/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25246.51 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | O55242 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
|---|
| BDBM50374605 |
|---|
| n/a |
|---|
| Name | BDBM50374605 |
|---|
| Synonyms: | CHEMBL273084 | US9604926, Compound SN-99 | US9724435, Compound SN-98 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H29N3OS |
|---|
| Mol. Mass. | 359.529 |
|---|
| SMILES | O=c1sc2ccccc2n1CCCN1CCN(CC1)C1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
