Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine-1-phosphate lyase 1
LigandBDBM313368
Substrate/Competitorn/a
Meas. Tech.S1P1 Binding Assay
IC50<10±n/a nM
Citation Dyckman AJDhar TGXiao HGilmore JLYang MGXiao ZMarcoux D Substituted bicyclic compounds US Patent  US10166249 Publication Date 1/1/2019
More Info.:Get all data from this article,  Assay Method
 
Sphingosine-1-phosphate lyase 1
Name:Sphingosine-1-phosphate lyase 1
Synonyms:KIAA1252 | S1PL | SGPL1 | SP-lyase 1 | SPL 1 | Sphingosine-1-phosphate aldolase | hSPL
Type:PROTEIN
Mol. Mass.:63546.76
Organism:Homo sapiens (Human)
Description:ChEMBL_108363
Residue:568
Sequence:
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFV
FQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQG
LSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQS
AHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKG
SSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP
PSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAE
LSSVFLDSLYSTDTVTQGSQMNGSPKPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM313368
n/a
NameBDBM313368
Synonyms:US10166249, Example 605
TypeSmall organic molecule
Emp. Form.C27H33N2O4P
Mol. Mass.480.5357
SMILESN[C@]1(COP(O)(O)=O)CC[C@@H](C1)c1ccc2C[C@@H](CCc3ccc4ccccc4n3)CCc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: