Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50077877 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 4.80±n/a nM |
---|
Citation | Torrens-Jover, A; Christmann, U; Diaz-Fernández, J; Almansa-Rosales, C 1,2,3-triazole-4-amine derivatives for the treatment of sigma receptor related diseases and disorders US Patent US9611229 Publication Date 4/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25246.51 |
Organism: | Mus musculus (Mouse) |
Description: | O55242 |
Residue: | 223 |
Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
BDBM50077877 |
---|
n/a |
---|
Name | BDBM50077877 |
Synonyms: | CHEMBL3417042 | US9611229, 2 |
Type | Small organic molecule |
Emp. Form. | C15H19Cl2N5 |
Mol. Mass. | 340.251 |
SMILES | Clc1ccc(cc1Cl)-n1cc(NCCN2CCCCC2)nn1 |
Structure |
|