Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNT-3 growth factor receptor (TRKC)
LigandBDBM164901
Substrate/Competitorn/a
Meas. Tech.TrkC Activity
IC50 0.503±n/a nM
Citation Kane, Jr. JLMatthews GMetz MKothe MLiu JScholte A Tropomyosin-related kinase (TRK) inhibitors US Patent  US9611265 Publication Date 4/4/2017
More Info.:Get all data from this article,  Assay Method
 
NT-3 growth factor receptor (TRKC)
Name:Neurotrophic tyrosine kinase receptor
Synonyms:GP145-TrkC | Neurotrophic tyrosine kinase receptor type 3 | Trk-C | TrkC tyrosine kinase | Tyrosine kinase receptor C (Trk-C)
Type:Enzyme
Mol. Mass.:94428.15
Organism:Homo sapiens (Human)
Description:Q16288
Residue:839
Sequence:
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM164901
n/a
NameBDBM164901
Synonyms:US10166239, Ex. 3-15 | US9067914, Ex. 3-15
TypeSmall organic molecule
Emp. Form.C26H26N6O3
Mol. Mass.470.523
SMILESCOc1ccc(COc2ccc(Cn3c(N)nc4cc(cnc34)-c3cnn(C)c3)cc2OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: