BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM10888
Substrate/Competitorn/a
Meas. Tech.Known Inhibitors of Carbonic Anhydrase
IC50 35.0±n/a nM
Citation Collier GRWalder KRCampbell JAMolero-Navajas JKonstantopoulos NKrippner GY Insulin sensitisers and methods of treatment US Patent  US10172837 Publication Date 1/8/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10888
n/a
NameBDBM10888
Synonyms:1,2-benzoxazol-3-ylmethanesulfonamide | CHEMBL750 | SPR_2 | US10172837, Zonisamide | Zonisamide | Zonisamide (ZNA) | Zonisamide (ZNS) | Zonisamide, 1 | Zonisamide, ZNS
TypeSmall organic molecule
Emp. Form.C8H8N2O3S
Mol. Mass.212.226
SMILESNS(=O)(=O)Cc1noc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: