Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein Kinase II
LigandBDBM11318
Substrate/CompetitorCK-2 Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 1850±n/a nM
Citation De Moliner EMoro SSarno SZagotto GZanotti GPinna LABattistutta R Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight. J Biol Chem 278:1831-6 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Casein Kinase II
Name:Casein Kinase II
Synonyms:CK II | CK2- alpha
Type:Enzyme
Mol. Mass.:39238.74
Organism:Zea mays (Maize)
Description:n/a
Residue:332
Sequence:
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY
PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLL
RYDHQERLTALEAMTHPYFQQVRAAENSRTRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
CK-2 Peptide Substrate
Name:CK-2 Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1446.31
Organism:n/a
Description:n/a
Residue:12
Sequence:
RRRADDSDDDDD