| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM323042 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FLAP Binding Assay (Test A) |
|---|
| IC50 | 25.0±n/a nM |
|---|
| Citation |  Broddefalk, JO; Emtenäs, HF; Granberg, KL; Lemurell, MA; Pettersen, DT; Plowright, AT; Ulander, LJ Pyrazole derivatives useful as 5-lipoxygenase activating protein (FLAP) inhibitors US Patent US10183947 Publication Date 1/22/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM323042 |
|---|
| n/a |
|---|
| Name | BDBM323042 |
|---|
| Synonyms: | (1R,2R)-N-[1-Methyl-5- (melhyIsulfamoyl)-1H-pyrazol-4-yl]-2-[4- (3-methyl-1H-pyrazol-5- yl)benzoyl]cyclohexanecarboxamide | US10183947, Example 25 | US10508119, Example 25 | US11001589, Example 25 | US11691978, Example 25 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H28N6O4S |
|---|
| Mol. Mass. | 484.571 |
|---|
| SMILES | CNS(=O)(=O)c1c(NC(=O)[C@@H]2CCCC[C@H]2C(=O)c2ccc(cc2)-c2cc(C)n[nH]2)cnn1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
