| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM324791 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TNF induced HEK-Blue assay |
|---|
| IC50 | <1000±n/a nM |
|---|
| Citation |  Xiao, H; Dhar, MT; Duan, J; Jiang, B; Tebben, AJ Substituted tricyclic heterocyclic compounds US Patent US10189840 Publication Date 1/29/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM324791 |
|---|
| n/a |
|---|
| Name | BDBM324791 |
|---|
| Synonyms: | US10189840, Example 37 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H27N3O |
|---|
| Mol. Mass. | 397.5121 |
|---|
| SMILES | Cc1ccc(C)c(c1)C1CCc2nc3ccc(nc3n12)-c1ccc(cc1)C(C)(C)O |
|---|
| Structure | 
|
|---|
Search and Browse
