| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nuclear receptor ROR-gamma [262-507] |
|---|
| Ligand | BDBM327613 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Spa Binding Assay |
|---|
| IC50 | 10.0±n/a nM |
|---|
| Citation |  Dhar, TG; Duan, J; Gong, H; Jiang, B; Lu, Z; Weinstein, DS RORγ modulators US Patent US9663469 Publication Date 5/30/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nuclear receptor ROR-gamma [262-507] |
|---|
| Name: | Nuclear receptor ROR-gamma [262-507] |
|---|
| Synonyms: | NR1F3 | Nuclear receptor ROR-gamma | Nuclear receptor ROR-gamma (aa 262-507) | ROR-gamma (A262-S507) | RORC | RORG | RORG_HUMAN | RZRG |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 28605.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 262-507 |
|---|
| Residue: | 246 |
|---|
| Sequence: | APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFS
|
|
|
|---|
| BDBM327613 |
|---|
| n/a |
|---|
| Name | BDBM327613 |
|---|
| Synonyms: | US9663469, 155 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H22F7N3O4S |
|---|
| Mol. Mass. | 605.524 |
|---|
| SMILES | OC(c1ccc2N([C@H](CC(=O)NCc3ccncc3)CCc2c1)S(=O)(=O)c1ccc(F)cc1)(C(F)(F)F)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
