Reaction Details |
| Report a problem with these data |
Target | Ubiquitin-conjugating enzyme E2 E1 |
---|
Ligand | BDBM329876 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | HTRF Assay |
---|
IC50 | <10±n/a nM |
---|
Citation | Afroze, R; Bharathan, IT; Ciavarri, JP; Fleming, PE; Gaulin, JL; Girard, M; Langston, SP; Soucy, F; Wong, T; Ye, Y Pyrazolopyrimidinyl inhibitors of ubiquitin-activating enzyme US Patent US9663525 Publication Date 5/30/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ubiquitin-conjugating enzyme E2 E1 |
---|
Name: | Ubiquitin-conjugating enzyme E2 E1 |
Synonyms: | E2 ubiquitin-conjugating enzyme E1 | UB2E1_HUMAN | UBCH6 | UBE2E1 |
Type: | n/a |
Mol. Mass.: | 21408.98 |
Organism: | Homo sapiens (Human) |
Description: | P51965 |
Residue: | 193 |
Sequence: | MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
|
|
|
BDBM329876 |
---|
n/a |
---|
Name | BDBM329876 |
Synonyms: | (rac)-((1R,2R,3S,4R)-4-(2-(3-(2-ethoxypropan-2-yl)phenyl)pyrazolo[1,5-a]pyrimidin- | US10202389, Compound I-084 | US9663525, Compound I-084 | US9796725, Compound I-084 |
Type | Small organic molecule |
Emp. Form. | C23H31N5O6S |
Mol. Mass. | 505.587 |
SMILES | CCOC(C)(C)c1cccc(c1)-c1cc2nccc(N[C@@H]3C[C@H](COS(N)(=O)=O)[C@@H](O)[C@H]3O)n2n1 |r| |
Structure |
|