Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnthrax Lethal Factor (LF)
LigandBDBM11996
Substrate/Competitorfluorogenic LF protease substrate III
Meas. Tech.Enzyme Inhibition Microplate Assay
pH7.2±n/a
Temperature300.15±n/a K
Ki 900±n/a nM
IC50 7600±n/a nM
Citation Schepetkin IAKhlebnikov AIKirpotina LNQuinn MT Novel small-molecule inhibitors of anthrax lethal factor identified by high-throughput screening. J Med Chem 49:5232-44 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Anthrax Lethal Factor (LF)
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11996
fluorogenic LF protease substrate III
Name:fluorogenic LF protease substrate III
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a