| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM312166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Receptor Assay |
|---|
| Ki | 7.59±0.08 nM |
|---|
| Citation |  McCurdy, CR; Mesangeau, C; Chin, FT; James, ML; Shen, B; Gambhir, S; Biswal, S; Behera, D Highly selective sigma receptor ligands and radioligands as probes in nociceptive processing and the pathphysiological study of memory deficits and cognitive disorders US Patent US9724435 Publication Date 8/8/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM312166 |
|---|
| n/a |
|---|
| Name | BDBM312166 |
|---|
| Synonyms: | US9604926, Compound CM-170 | US9724435, Compound CM-170 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24FN3O2 |
|---|
| Mol. Mass. | 369.4326 |
|---|
| SMILES | Fc1ccc(cc1)N1CCN(CCCCn2c3ccccc3oc2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
