Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM12214 |
---|
Substrate/Competitor | Fluorogenic Peptide Substrate |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 5±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 0.9±n/a nM |
---|
Citation | Andersson, HO; Fridborg, K; Lowgren, S; Alterman, M; Muhlman, A; Bjorsne, M; Garg, N; Kvarnstrom, I; Schaal, W; Classon, B; Karlen, A; Danielsson, UH; Ahlsen, G; Nillroth, U; Vrang, L; Oberg, B; Samuelsson, B; Hallberg, A; Unge, T Optimization of P1-P3 groups in symmetric and asymmetric HIV-1 protease inhibitors. Eur J Biochem270:1746-58 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM12214 |
---|
Fluorogenic Peptide Substrate |
---|
Name: | Fluorogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 4156.59 |
Organism: | n/a |
Description: | n/a |
Residue: | 39 |
Sequence: | DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS
|
|
|