Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM167060
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 0.400±n/a nM
Citation Eccles WFitzgerald AEHack MDHawryluk NAJones WMKeith JMKrawczuk PLebsack ADLiu JMani NSMcClure KJMeduna SPRosen MD FLAP modulators US Patent  US9732093 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167060
n/a
NameBDBM167060
Synonyms:US9073876, 146 | US9732093, Compound 146
TypeSmall organic molecule
Emp. Form.C25H23FN6O
Mol. Mass.442.4881
SMILESNc1cnc(cn1)-c1ccc(C2CCC2)c(Oc2cc(N)nc(Cc3ccccc3)n2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: