| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 Protease Mutant V6(46/54/84) |
|---|
| Ligand | BDBM520 |
|---|
| Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| Ki | 624±n/a nM |
|---|
| Citation |  Clemente JC; Moose RE; Hemrajani R; Whitford LR; Govindasamy L; Reutzel R; McKenna R; Agbandje-McKenna M; Goodenow MM; Dunn BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry 43:12141-51 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| HIV-1 Protease Mutant V6(46/54/84) |
|---|
| Name: | HIV-1 Protease Mutant V6(46/54/84) |
|---|
| Synonyms: | HIV-1 protease mutant (K20R V32I L33F M36I M46I I54V L63P A71V V82A I84V L90M) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | The post-ritonavir therapy protease variant plus M46I/I54V/I84V mutations, which were created by site-directed mutagenesis.
|
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | HIV-1 Protease Mutant V6(46/54/84) chain A |
|---|
| Synonyms: | HIV-1 Protease Mutant V6(46/54/84) chain B |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10795.08 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | n/a |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | HIV-1 Protease Mutant V6(46/54/84) chain A |
|---|
| Synonyms: | HIV-1 Protease Mutant V6(46/54/84) chain B |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10795.08 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | n/a |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
|
|
|
|---|
| BDBM520 |
|---|
| HIV Protease Chromogenic Peptide Substrate |
|---|
| Name: | HIV Protease Chromogenic Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1420.11 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 13 |
|---|
| Sequence: | |
|---|
Search and Browse
