Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
---|
Ligand | BDBM13935 |
---|
Substrate/Competitor | Chromogenic Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 330±n/a nM |
---|
Km | 46000±4000 nM |
---|
Comments | kcat/Km=6.1 +/- 0.6 min-1uM-1 |
---|
Citation | Liu, F; Boross, PI; Wang, YF; Tozser, J; Louis, JM; Harrison, RW; Weber, IT Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. J Mol Biol354:789-800 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
---|
Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
Synonyms: | HIV-1 Protease Mutant (G73S) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | The HIV-1 PR DNA for all of wildtype and mutants was cloned, and protein was expressed, purified, and refolded from Escherichia coli strain BL21. |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
Synonyms: | HIV-1 Protease Mutant (G73S) chain A | HIV-1 Protease Mutant (G73S) chain B | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10762.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03367[501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAISTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
Synonyms: | HIV-1 Protease Mutant (G73S) chain A | HIV-1 Protease Mutant (G73S) chain B | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10762.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03367[501-599,Q508K,L534I,L564I,C568A,C596A,G574S] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAISTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
BDBM13935 |
---|
Chromogenic Substrate |
---|
Name: | Chromogenic Substrate |
Synonyms: | CA/p2# |
Type: | Peptide |
Mol. Mass.: | 2887.67 |
Organism: | n/a |
Description: | n/a |
Residue: | 25 |
Sequence: | K-A-R-V-Nle-(p-nitroPhe)-E-A-Nle-amide
|
|
|