| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM12597 |
|---|
| Substrate/Competitor | BDBM12500 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants. |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 69±n/a nM |
|---|
| Citation |  Maignan, S; Guilloteau, JP; Pouzieux, S; Choi-Sledeski, YM; Becker, MR; Klein, SI; Ewing, WR; Pauls, HW; Spada, AP; Mikol, V Crystal structures of human factor Xa complexed with potent inhibitors. J Med Chem43:3226-32 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM12597 |
|---|
| BDBM12500 |
|---|
| Name | BDBM12597 |
|---|
| Synonyms: | CHEMBL48046 | RPR128515 | methyl (2R,3R)-2-{3-[amino(imino)methyl]benzyl}-3-({[3-(aminomethyl)-1,1-biphenyl-4-yl]carbonyl}amino)butanoate | methyl (2R,3R)-3-({4-[3-(aminomethyl)phenyl]phenyl}formamido)-2-[(3-carbamimidoylphenyl)methyl]butanoate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H30N4O3 |
|---|
| Mol. Mass. | 458.5521 |
|---|
| SMILES | COC(=O)[C@H](Cc1cccc(c1)C(N)=N)[C@@H](C)NC(=O)c1ccc(cc1)-c1cccc(CN)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
