| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Ligand | BDBM14250 |
|---|
| Substrate/Competitor | BDBM13466 |
|---|
| Meas. Tech. | Enzymatic Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 300±n/a nM |
|---|
| Citation |  Wan, ZK; Lee, J; Xu, W; Erbe, DV; Joseph-McCarthy, D; Follows, BC; Zhang, YL Monocyclic thiophenes as protein tyrosine phosphatase 1B inhibitors: capturing interactions with Asp48. Bioorg Med Chem Lett16:4941-5 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34670.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
|---|
| BDBM14250 |
|---|
| BDBM13466 |
|---|
| Name | BDBM14250 |
|---|
| Synonyms: | 4-bromo-3-(carboxymethoxy)-5-(4-hydroxyphenyl)thiophene-2-carboxylic acid | Monocyclic thiophene analog 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H9BrO6S |
|---|
| Mol. Mass. | 373.176 |
|---|
| SMILES | OC(=O)COc1c(Br)c(sc1C(O)=O)-c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
