Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 3
LigandBDBM342461
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinases In Vitro Assay
IC50 10.5±n/a nM
Citation Zdzalik DLipner JWieczorek MDzwonek KYamani ADubiel KLamparska-Przybysz MGrygielewicz PStanczak A Pyrazolylbenzo[d]imidazole derivatives US Patent  US9776988 Publication Date 10/3/2017
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 3
Name:Fibroblast growth factor receptor
Synonyms:CD_antigen: CD333 | FGFR-3 | FGFR3 | Fibroblast growth factor receptor 3 (FGFR3) | JTK4
Type:Protein
Mol. Mass.:87699.57
Organism:Homo sapiens (Human)
Description:P22607
Residue:806
Sequence:
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM342461
n/a
NameBDBM342461
Synonyms:US9776988, Example 21
TypeSmall organic molecule
Emp. Form.C29H35N7O4
Mol. Mass.545.6327
SMILESCOc1cc(CCc2cc(n[nH]2)-c2nc3ccc(cc3[nH]2)N2CCN(CC2)C(=O)N2CCOCC2)cc(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: