| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Malignant T-cell-amplified sequence 1 |
|---|
| Ligand | BDBM345278 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Assay 4: MCT1-Mediated Lactate Transport in BT20 Breast Cancer Cells |
|---|
| IC50 | 100000±n/a nM |
|---|
| Citation |  Parnell, KM; McCall, J MCT4 inhibitors for treating disease US Patent US10202350 Publication Date 2/12/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Malignant T-cell-amplified sequence 1 |
|---|
| Name: | Malignant T-cell-amplified sequence 1 |
|---|
| Synonyms: | MCT-1 | MCT1 | MCTS1 | MCTS1_HUMAN | Multiple copies T-cell malignancies |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20563.62 |
|---|
| Organism: | Homo sapiens (human) |
|---|
| Description: | n/a |
|---|
| Residue: | 181 |
|---|
| Sequence: | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|
|
|---|
| BDBM345278 |
|---|
| n/a |
|---|
| Name | BDBM345278 |
|---|
| Synonyms: | 2-[[1-[(2-Chlorophenyl)methyl]-5-(3- thienyl)pyrazol-3-yl]methoxy]-2-methyl- propanoic acid. 1HNMR (CDCl3): $#948; 1.37 (s, 6H), 4.38 (s, 2H), 5.43 (s, 2H), 6.48 (s, 1H), 6.62-6.64 (m, 1H), 7.17-7.31 (m, 3H), 7.44-7.46 (m, 1H), 7.57-7.64 (m, 2H). | US10202350, Example 24 | US10214492, Example 24 | US11292767, Example 24 | US11724989, Example 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H19ClN2O3S |
|---|
| Mol. Mass. | 390.884 |
|---|
| SMILES | CC(C)(OCc1cc(-c2ccsc2)n(Cc2ccccc2Cl)n1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
