Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Ligand | BDBM15690 |
---|
Substrate/Competitor | BDBM15648 |
---|
Meas. Tech. | Enoyl-CoA Reductase Inhibition Assay |
---|
IC50 | 4470±n/a nM |
---|
Citation | He, X; Alian, A; Stroud, R; Ortiz de Montellano, PR Pyrrolidine carboxamides as a novel class of inhibitors of enoyl acyl carrier protein reductase from Mycobacterium tuberculosis. J Med Chem49:6308-23 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
Type: | Enzyme |
Mol. Mass.: | 28526.00 |
Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Description: | P9WGR1 |
Residue: | 269 |
Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
BDBM15690 |
---|
BDBM15648 |
---|
Name | BDBM15690 |
Synonyms: | 1-Cyclohexyl-4-(1-(phenyl(4-chlorophenyl)methyl)piperazine-4-carbonyl)pyrrolidin-2-one | 4-({4-[(4-chlorophenyl)(phenyl)methyl]piperazin-1-yl}carbonyl)-1-cyclohexylpyrrolidin-2-one | Pyrrolidine Carboxamide Compound p37 |
Type | Small organic molecule |
Emp. Form. | C28H34ClN3O2 |
Mol. Mass. | 480.041 |
SMILES | Clc1ccc(cc1)C(N1CCN(CC1)C(=O)C1CN(C2CCCCC2)C(=O)C1)c1ccccc1 |
Structure |
|