Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor Xa (fXa)
LigandBDBM17111
Substrate/CompetitorBDBM12658
Meas. Tech.Enzyme Inhibition Assay
Ki 0.15±n/a nM
Citation Ye BArnaiz DOChou YLGriedel BDKaranjawala RLee WMorrissey MMSacchi KLSakata STShaw KJWu SCZhao ZAdler MCheeseman SDole WPEwing JFitch RLentz DLiang ALight DMorser JPost JRumennik GSubramanyam BSullivan MEVergona RWalters JWang YXWhite KAWhitlow MKochanny MJ Thiophene-anthranilamides as highly potent and orally available factor xa inhibitors J Med Chem 50:2967-80 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Factor Xa (fXa)
Name:Factor Xa (fXa)
Synonyms:Coagulation factor X precursor | Stuart factor | Stuart-Prower factor
Type:Enzyme
Mol. Mass.:17844.67
Organism:Canis lupus familiaris (Dog)
Description:n/a
Residue:159
Sequence:
ILSEYYILTAAHCLQQAKKFTVRVGERDTDKEEGNEVAHEVEMIIKHNKFVRETYDFDIA
VIKLKTPITFRMNVAPACLPQKDWAESTLMTQKTGIVSGFGKTHEKGRPSTTLKMMEVPY
VDRNTCKLSSSFSITQNMFCAGYDSKPEDGCQGDSGGPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17111
BDBM12658
NameBDBM17111
Synonyms:3-chloro-N-{4-chloro-2-[(5-chloropyridin-2-yl)carbamoyl]-6-methoxyphenyl}-4-{[4,5-dihydro-1,3-oxazol-2-yl(methyl)amino]methyl}thiophene-2-carboxamide | Thiophene-Anthranilamide, 13a | ZK 810388 | ZK810388
TypeSmall organic molecule
Emp. Form.C23H20Cl3N5O4S
Mol. Mass.568.86
SMILESCOc1cc(Cl)cc(C(=O)Nc2ccc(Cl)cn2)c1NC(=O)c1scc(CN(C)C2=NCCO2)c1Cl |t:31|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: