Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Ligand | BDBM17348 |
---|
Substrate/Competitor | BDBM17342 |
---|
Meas. Tech. | Fluorescence Polarization Affinity Measurements. |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 3000±n/a nM |
---|
Citation | Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K Design, synthesis, and biological activity of a potent Smac mimetic that sensitizes cancer cells to apoptosis by antagonizing IAPs. ACS Chem Biol1:525-33 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
Type: | Protein Binding Domain |
Mol. Mass.: | 13276.62 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 of XIAP: RESIDUES 241-356. |
Residue: | 116 |
Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
BDBM17348 |
---|
BDBM17342 |
---|
Name | BDBM17348 |
Synonyms: | (3R,6S,9aS)-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-octahydroazepino[2,1-b][1,3]thiazole-3-carboxamide | peptide isostere, 11 |
Type | Small organic molecule |
Emp. Form. | C23H30N6O3S |
Mol. Mass. | 470.588 |
SMILES | [H][C@]12CCC[C@H](NC(=O)[C@H](C)NC)C(=O)N1[C@@H](CS2)C(=O)Nc1cc(C)nn1-c1ccccc1 |r| |
Structure |
|