| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18045 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 6.4±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 34±n/a nM |
|---|
| Citation |  Whitlow, M; Howard, AJ; Stewart, D; Hardman, KD; Chan, JH; Baccanari, DP; Tansik, RL; Hong, JS; Kuyper, LF X-Ray crystal structures of Candida albicans dihydrofolate reductase: high resolution ternary complexes in which the dihydronicotinamide moiety of NADPH is displaced by an inhibitor. J Med Chem44:2928-32 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DFR1 | DYR_CANAX | Dihydrofolate Reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 22141.77 |
|---|
| Organism: | Candida albicans |
|---|
| Description: | C. albicans DHFR was expressed in E. coli BL21, and purified to homogeneity. |
|---|
| Residue: | 192 |
|---|
| Sequence: | MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENKIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
|
|
|
|---|
| BDBM18045 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18045 |
|---|
| Synonyms: | 5-(PHENYLSULFANYL)-2,4-QUINAZOLINEDIAMINE | 5-(phenylsulfanyl)quinazoline-2,4-diamine | GW997 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12N4S |
|---|
| Mol. Mass. | 268.337 |
|---|
| SMILES | Nc1nc(N)c2c(Sc3ccccc3)cccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
