Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18251 |
---|
Substrate/Competitor | BDBM18044 |
---|
Meas. Tech. | Dihydrofolate Reductase (DHFR) Assay |
---|
IC50 | 6330±n/a nM |
---|
Citation | Gangjee, A; Zeng, Y; Talreja, T; McGuire, JJ; Kisliuk, RL; Queener, SF Design and Synthesis of Classical and Nonclassical 6-Arylthio-2,4-diamino-5-ethylpyrrolo[2,3-d]pyrimidines as Antifolates. J Med Chem50:3046-3053 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM18251 |
---|
BDBM18044 |
---|
Name | BDBM18251 |
Synonyms: | 6-[(3-chlorophenyl)sulfanyl]-5-ethyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine | Pyrrolo[2, 3-d]pyrimidine analogue, 7 |
Type | Small organic molecule |
Emp. Form. | C14H14ClN5S |
Mol. Mass. | 319.812 |
SMILES | CCc1c(Sc2cccc(Cl)c2)[nH]c2nc(N)nc(N)c12 |
Structure |
|