Reaction Details |
| Report a problem with these data |
Target | Cathepsin S |
---|
Ligand | BDBM19555 |
---|
Substrate/Competitor | BDBM19546 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 35±n/a nM |
---|
Citation | Liu, H; Tully, DC; Epple, R; Bursulaya, B; Li, J; Harris, JL; Williams, JA; Russo, R; Tumanut, C; Roberts, MJ; Alper, PB; He, Y; Karanewsky, DS Design and synthesis of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 1. Bioorg Med Chem Lett15:4979-84 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Cathepsin S |
---|
Name: | Cathepsin S |
Synonyms: | CATS_HUMAN | CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein |
Type: | Protein |
Mol. Mass.: | 37507.38 |
Organism: | Homo sapiens (Human) |
Description: | P25774 |
Residue: | 331 |
Sequence: | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
|
|
|
BDBM19555 |
---|
BDBM19546 |
---|
Name | BDBM19555 |
Synonyms: | (2S)-3-(2-chlorophenyl)-N-{2-[(4-methoxyphenyl)amino]ethyl}-2-[(3-methylphenyl)formamido]propanamide | arylaminoethyl amide, 5i |
Type | Small organic molecule |
Emp. Form. | C26H28ClN3O3 |
Mol. Mass. | 465.972 |
SMILES | COc1ccc(NCCNC(=O)[C@H](Cc2ccccc2Cl)NC(=O)c2cccc(C)c2)cc1 |r| |
Structure |
|