| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin S |
|---|
| Ligand | BDBM19545 |
|---|
| Substrate/Competitor | BDBM19546 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 68±n/a nM |
|---|
| Citation |  Alper, PB; Liu, H; Chatterjee, AK; Nguyen, KT; Tully, DC; Tumanut, C; Li, J; Harris, JL; Tuntland, T; Chang, J; Gordon, P; Hollenbeck, T; Karanewsky, DS Arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 2: Optimization of P1 and N-aryl. Bioorg Med Chem Lett16:1486-90 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Cathepsin S |
|---|
| Name: | Cathepsin S |
|---|
| Synonyms: | CATS_HUMAN | CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37507.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25774 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
|
|
|
|---|
| BDBM19545 |
|---|
| BDBM19546 |
|---|
| Name | BDBM19545 |
|---|
| Synonyms: | (2S)-N-{2-[(4-methoxyphenyl)amino]ethyl}-4-methyl-2-[(3-methylphenyl)formamido]pentanamide | CHEMBL64765 | arylaminoethyl amide, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H31N3O3 |
|---|
| Mol. Mass. | 397.5105 |
|---|
| SMILES | COc1ccc(NCCNC(=O)[C@H](CC(C)C)NC(=O)c2cccc(C)c2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
