| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50199790 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Uptake Assays |
|---|
| Ki | 4.03±0.22 nM |
|---|
| Citation |  Newman, AH; Okunola-Bakare, OM; Cao, J Potent and selective inhibitors of monoamine transporters; method of making; and use thereof US Patent US9862679 Publication Date 1/9/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50199790 |
|---|
| n/a |
|---|
| Name | BDBM50199790 |
|---|
| Synonyms: | CHEMBL3916231 | US10913711, Compound 9d | US11555013, Compound 9d | US9862679, Compound 9d |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28F2N2OS |
|---|
| Mol. Mass. | 406.532 |
|---|
| SMILES | CC(O)CN1CCN(CCSC(c2ccc(F)cc2)c2ccc(F)cc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
